PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma6g01400.1
Common NameZOSMA_6G01400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family EIL
Protein Properties Length: 558aa    MW: 62154.9 Da    PI: 4.9865
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma6g01400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3368.11.5e-112363522321
                     XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWk 96 
                     el+ rmwkd +++kr+ker k  +  ++ +++++k++   +q+rrkkmsraQDgiLkYMlk mevcna+GfvYgiipekgkpv+g+sd+LraWWk
  Zosma6g01400.1  36 ELSMRMWKDHVRMKRIKERDKIMV--QQ-ELRNSKNRAYMDQSRRKKMSRAQDGILKYMLKLMEVCNARGFVYGIIPEKGKPVSGSSDNLRAWWK 127
                     999****************99855..33.378999************************************************************ PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT-- CS
            EIN3  97 ekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqg 191
                     e+v+fd+ gpaai ++++++l l +++++   + +   +l+ lqD+tlgSLLs+l qhcdppqr++pl++gv+pPWWP+G+e+ww  l   + q 
  Zosma6g01400.1 128 ENVKFDKSGPAAIDDHDSADLSLISAQQS---SGKHLDNLMSLQDATLGSLLSSLLQHCDPPQRKYPLNNGVSPPWWPSGTEDWWMDLDPLAGQI 219
                     ****************9999888866555...7999*****************************************************999999 PP

                     .-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXX.XXXXXXXXXXXXXXXX CS
            EIN3 192 tppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrk.qspkvtlsceqkedve 285
                     +ppykkphdlkka kv+vLtavikhmsp+i++ir+l  +sk lqdkm+akes ++  +l++ee+ +++  +++s l+   s++ +++++  e+ +
  Zosma6g01400.1 220 PPPYKKPHDLKKASKVGVLTAVIKHMSPNIAKIRNLIHKSKLLQDKMTAKESSIWRTILKREESNLKQPITENSMLSPtVSQSNVCNKR--EETD 312
                     **********************************************************************9977554324444444444..4444 PP

                     ....XXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3 286 ....gkkeskikhvqavkttagfpvvrkrkkkpsesakvs 321
                          +   ki++    k + ++    krk++ +  + v 
  Zosma6g01400.1 313 gagcCTTSDKIQTGMVTKDNGNVCWRPKRKRNLATLTHVT 352
                     4466333444443333333345556666665555444443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.4E-11336282No hitNo description
Gene3DG3DSA:1.10.3180.104.0E-61156288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167687.85E-54163284IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MIGGAIEEDM DIEVSNIQPA NLTENDVSDE EIDEQELSMR MWKDHVRMKR IKERDKIMVQ  60
QELRNSKNRA YMDQSRRKKM SRAQDGILKY MLKLMEVCNA RGFVYGIIPE KGKPVSGSSD  120
NLRAWWKENV KFDKSGPAAI DDHDSADLSL ISAQQSSGKH LDNLMSLQDA TLGSLLSSLL  180
QHCDPPQRKY PLNNGVSPPW WPSGTEDWWM DLDPLAGQIP PPYKKPHDLK KASKVGVLTA  240
VIKHMSPNIA KIRNLIHKSK LLQDKMTAKE SSIWRTILKR EESNLKQPIT ENSMLSPTVS  300
QSNVCNKREE TDGAGCCTTS DKIQTGMVTK DNGNVCWRPK RKRNLATLTH VTDTQELQGI  360
PVVNQSKLPQ YECVSSDSNS ESGIQFLLPD CGYDTTFPAS LIDHSAQSMC ITDSSLQPDI  420
RNLETNCGNS PAVFSHAPIV DNQLLNGNGG VARMVENRIV DRNNGVVQQI KNGNVEINTG  480
NQAVVGANTL DVNVHQSLPD SAFDNTQHKH VDGGLSNDDF SLNFDDIGEM PFDFGPLDFE  540
DLEEFLDGEE IMEYLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-521632835125Protein ETHYLENE INSENSITIVE 3
4zds_B3e-521632835125Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008797493.11e-131PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_008797494.11e-131PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-115EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0K9NRI90.0A0A0K9NRI9_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-116ETHYLENE-INSENSITIVE3-like 3